Structure of PDB 7uvx Chain Q

Receptor sequence
>7uvxQ (length=103) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVVNGDNIQIG
APVVAGAKVTAEVIGHGRHDKIRIIKMRRRKHYRKQQGHRQWFTELKITG
ISG
3D structure
PDB7uvx Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
ChainQ
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q G8 K10 T19 E23 R68 K71 K76 R78 R79 R80 K81 Y83 K85 G88 H89 Q91 G8 K10 T19 E23 R68 K71 K76 R78 R79 R80 K81 Y83 K85 G88 H89 Q91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvx, PDBe:7uvx, PDBj:7uvx
PDBsum7uvx
PubMed37192172
UniProtB7I6V9|RL21_ACIB5 Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]