Structure of PDB 7unr Chain Q

Receptor sequence

>7unrQ (length=115) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]

SVKKETRLRRARKARLKMRELETVRLCVYRSSQHIYAQVIAADGGKVLAS
ASTLDKDLREGATGNIDAAKKVGQLVAERAKAAGVTQVAFDRSGFKYHGR
VKALADAAREGGLEF

3D structure

PDB

7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	R10 R11 R13 K14 L17 K18 E21 L22 F91 R93 Y98 R110 F116	R9 R10 R12 K13 L16 K17 E20 L21 F90 R92 Y97 R109 F115
BS02	rna	Q	S2 K4 R16 R20 R26 Y30 R31 S32 S33 Q34 H35 Y37 I41 G45 V48 S51 K57 N66 I67 H99 G100 R101	S1 K3 R15 R19 R25 Y29 R30 S31 S32 Q33 H34 Y36 I40 G44 V47 S50 K56 N65 I66 H98 G99 R100

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum	7unr
PubMed
UniProt	Q9HWF1\|RL18_PSEAE Large ribosomal subunit protein uL18 (Gene Name=rplR)