Structure of PDB 7ubn Chain Q

Receptor sequence

>7ubnQ (length=207) Species: 562 (Escherichia coli) [Search protein sequence]

MRLESVAKFHSPKSPMMSDSPRATASDSLSGTDVMAAMGMAQSQAGFGMA
AFCGKHELSQNDKQKAINYLMQFAHKVSGKYRGVAKLEGNTKAKVLQVLA
TFAYADYCRSAATPGARCRDCHGTGRAVDIAKTELWGRVVEKECGRCKGV
GYSRMPASAAYRAVTMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIADN
ILNAVTR

3D structure

PDB

7ubn In transcription antitermination by Q lambda , NusA induces refolding of Q lambda to form a nozzle that extends the RNA polymerase RNA-exit channel.

Chain

Resolution

3.36 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	Q	R82 R119 I130 R146 K148 S153 R154 T172 R178	R82 R119 I130 R146 K148 S153 R154 T172 R178
BS02	dna	Q	V128 K142 R154 P156 A157 S158 R162 Q173 S177 R178 K181	V128 K142 R154 P156 A157 S158 R162 Q173 S177 R178 K181
BS03	rna	Q	K13 M16 R22	K13 M16 R22
BS04	ZN	Q	C118 C121 C144 C147	C118 C121 C144 C147

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006353	DNA-templated transcription termination
GO:0006355	regulation of DNA-templated transcription
GO:0031564	transcription antitermination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7ubn, PDBe:7ubn, PDBj:7ubn
PDBsum	7ubn
PubMed	35951650
UniProt	P03047\|REGQ_LAMBD Antitermination protein Q (Gene Name=Q)

[Back to BioLiP]