Structure of PDB 7ttw Chain Q

Receptor sequence
>7ttwQ (length=64) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVS
KSDMKRVKQLLAYK
3D structure
PDB7ttw A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.
ChainQ
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q P2 K3 M4 K5 H7 R8 K12 R13 T17 A18 S19 K23 R24 A27 F28 S30 H31 F33 N35 K39 Q40 R42 R45 R57 Q60 Y64 P1 K2 M3 K4 H6 R7 K11 R12 T16 A17 S18 K22 R23 A26 F27 S29 H30 F32 N34 K38 Q39 R41 R44 R56 Q59 Y63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ttw, PDBe:7ttw, PDBj:7ttw
PDBsum7ttw
PubMed35736238
UniProtQ2FXQ0|RL35_STAA8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]