Structure of PDB 7syh Chain Q

Receptor sequence
>7syhQ (length=115) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
FRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLSRGLRRKQHSLLKRLR
KAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEM
IGHYLGEFSITYKPV
3D structure
PDB7syh Molecular architecture of 40S initiation complexes on the Hepatitis C virus IRES: from ribosomal attachment to eIF5B-mediated reorientation of initiator tRNA
ChainQ
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q S38 A39 R40 R42 R43 R44 R47 S55 L56 R59 K77 T78 H79 D82 Y97 K100 Y115 E118 S120 T122 Y123 V126 S27 A28 R29 R31 R32 R33 R36 S44 L45 R48 K66 T67 H68 D71 Y86 K89 Y104 E107 S109 T111 Y112 V115
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0097371 MDM2/MDM4 family protein binding
GO:1990948 ubiquitin ligase inhibitor activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000056 ribosomal small subunit export from nucleus
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:1901798 positive regulation of signal transduction by p53 class mediator
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7syh, PDBe:7syh, PDBj:7syh
PDBsum7syh
PubMed
UniProtG1U0Q2|RS15_RABIT Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]