Structure of PDB 7q08 Chain Q

Receptor sequence
>7q08Q (length=118) Species: 237561 (Candida albicans SC5314) [Search protein sequence]
FKQFSFKGVDLKDLVEMPTEEFTKLCGARVRRRFSRGLDSKPMGLIKKLR
AARAATEPNERPAVVKTHLRNMIVVPEMIGSVVGVYNGKVFNTVEIKPEM
VGHYLGEFSITYTPVRHG
3D structure
PDB7q08 E-site drug specificity of the human pathogen Candida albicans ribosome.
ChainQ
Resolution2.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q R72 V75 R61 V64
BS02 rna Q C37 G38 A39 R40 R42 R43 R44 R47 K59 K77 T78 H79 R81 Y97 N98 G99 K100 F102 Y115 T122 Y123 T124 V126 R127 H128 C26 G27 A28 R29 R31 R32 R33 R36 K48 K66 T67 H68 R70 Y86 N87 G88 K89 F91 Y104 T111 Y112 T113 V115 R116 H117
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q08, PDBe:7q08, PDBj:7q08
PDBsum7q08
PubMed35613268
UniProtA0A1D8PK22|RS15_CANAL Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]