Structure of PDB 7po1 Chain Q

Receptor sequence
>7po1Q (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
AKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRR
RQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
3D structure
PDB7po1 Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
ChainQ
Resolution2.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q A2 K3 H4 K6 D38 R42 K47 P48 C49 R50 R52 Y57 R59 R62 Y64 N65 M66 I72 R80 D82 A1 K2 H3 K5 D37 R41 K46 P47 C48 R49 R51 Y56 R58 R61 Y63 N64 M65 I71 R79 D81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7po1, PDBe:7po1, PDBj:7po1
PDBsum7po1
PubMed35676484
UniProtP82921|RT21_HUMAN Small ribosomal subunit protein bS21m (Gene Name=MRPS21)

[Back to BioLiP]