Structure of PDB 7pir Chain Q

Receptor sequence
>7pirQ (length=65) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
YCRFCAIGQLRIDLIDDLEALKRFLSPYAKINPRRITGNCQMHQRHVAKA
LKRARYLALVPFVKD
3D structure
PDB7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainQ
Resolution12.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q C44 A45 K69 I70 P72 R73 R74 C79 Q80 M81 Q83 R84 H85 K88 K91 R92 R94 Y95 F101 V102 K103 C5 A6 K30 I31 P33 R34 R35 C40 Q41 M42 Q44 R45 H46 K49 K52 R53 R55 Y56 F62 V63 K64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum7pir
PubMed36171285
UniProtP75541|RS18_MYCPN Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]