Structure of PDB 7p7u Chain Q

Receptor sequence

>7p7uQ (length=125) Species: 1351 (Enterococcus faecalis) [Search protein sequence]

SYRKLGRTSSQRKAMLRDITTDLIINERIVTTEARAKEVRSTVEKMITLG
KRGDLHARRQAATFVRNEVASVREEDESIVVESALQKLFNDLGPRFAERQ
GGYTRILKTEPRRGDAAPMVVIEFV

3D structure

PDB

7p7u Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	S2 Y3 R4 K5 G7 R8 S10 S11 Q12 R13 K14 L17 R18 D23 I30 V31 R36 K38 E39 S42 E45 K46 T49 R53 L56 H57 R59 R60 Q61 T64 R67 N68 E69 L86 R100 Q101 G102 G103 T105 R106 K109 R113 R114 G115 D116 A117	S1 Y2 R3 K4 G6 R7 S9 S10 Q11 R12 K13 L16 R17 D22 I29 V30 R35 K37 E38 S41 E44 K45 T48 R52 L55 H56 R58 R59 Q60 T63 R66 N67 E68 L85 R99 Q100 G101 G102 T104 R105 K108 R112 R113 G114 D115 A116
BS02	MG	Q	D23 E69	D22 E68

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links