Structure of PDB 7p7r Chain Q

Receptor sequence

>7p7rQ (length=125) Species: 226185 (Enterococcus faecalis V583)

SYRKLGRTSSQRKAMLRDITTDLIINERIVTTEARAKEVRSTVEKMITLG
KRGDLHARRQAATFVRNEVASVREEDESIVVESALQKLFNDLGPRFAERQ
GGYTRILKTEPRRGDAAPMVVIEFV

3D structure

• PDB: 7p7r Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
• Chain: Q
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	Y3 R4 K5 L6 G7 S10 S11 Q12 R13 K14 A15 L17 R18 D19 D23 N27 I30 T32 T33 R36 K38 S42 E45 K46 T49 R53 L56 H57 R59 R60 Q61 T64 R67 N68 E69 R100 Q101 G102 G103 T105 R106 K109 R113 R114 G115 D116 A117 A118	Y2 R3 K4 L5 G6 S9 S10 Q11 R12 K13 A14 L16 R17 D18 D22 N26 I29 T31 T32 R35 K37 S41 E44 K45 T48 R52 L55 H56 R58 R59 Q60 T63 R66 N67 E68 R99 Q100 G101 G102 T104 R105 K108 R112 R113 G114 D115 A116 A117
BS02	MG	Q	D23 E69	D22 E68

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7p7r, PDBe:7p7r, PDBj:7p7r
• PDBsum: 7p7r
• PubMed: 35387982
• UniProt: Q839D8|RL17_ENTFA Large ribosomal subunit protein bL17 (Gene Name=rplQ)