Structure of PDB 7ooc Chain Q

Receptor sequence
>7oocQ (length=65) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
YCRFCAIGQLRIDLIDDLEALKRFLSPYAKINPRRITGNCQMHQRHVAKA
LKRARYLALVPFVKD
3D structure
PDB7ooc Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainQ
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q A45 K69 I70 R84 K88 K91 R92 Y95 F101 A6 K30 I31 R45 K49 K52 R53 Y56 F62
BS02 ZN Q C44 C79 H82 C5 C40 H43
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ooc, PDBe:7ooc, PDBj:7ooc
PDBsum7ooc
PubMed36171285
UniProtP75541|RS18_MYCPN Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]