Structure of PDB 7m4y Chain Q

Receptor sequence
>7m4yQ (length=103) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVVNGDNIQIG
APVVAGAKVTAEVIGHGRHDKIRIIKMRRRKHYRKQQGHRQWFTELKITG
ISG
3D structure
PDB7m4y Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
ChainQ
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q G8 K10 T19 E23 R68 K71 K76 R78 R79 R80 K81 Y83 K85 Q86 G88 H89 R90 Q91 G8 K10 T19 E23 R68 K71 K76 R78 R79 R80 K81 Y83 K85 Q86 G88 H89 R90 Q91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m4y, PDBe:7m4y, PDBj:7m4y
PDBsum7m4y
PubMed34044590
UniProtB7I6V9|RL21_ACIB5 Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]