Structure of PDB 7cun Chain Q

Receptor sequence

>7cunQ (length=293) Species: 9606 (Homo sapiens) [Search protein sequence]

DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCP
VTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLV
ALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD
YLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWS
DPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWC
HDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPR

3D structure

PDB

7cun Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.

Chain

Resolution

3.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D57 H59 D85 D88 R89 N117 H118 H167 R214 H241
Catalytic site (residue number reindexed from 1)	D56 H58 D84 D87 R88 N116 H117 H166 R213 H240
Enzyme Commision number	3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	Q	D85 N117 H167 H241	D84 N116 H166 H240
BS02	MN	Q	D57 H59 D85 H118	D56 H58 D84 H117

Gene Ontology

	Molecular Function
GO:0004721	phosphoprotein phosphatase activity
GO:0004722	protein serine/threonine phosphatase activity
GO:0004725	protein tyrosine phosphatase activity
GO:0005515	protein binding
GO:0016787	hydrolase activity
GO:0017018	myosin phosphatase activity
GO:0046872	metal ion binding
GO:0046982	protein heterodimerization activity
GO:0048156	tau protein binding
GO:0050811	GABA receptor binding

	Biological Process
GO:0000278	mitotic cell cycle
GO:0001932	regulation of protein phosphorylation
GO:0006470	protein dephosphorylation
GO:0007498	mesoderm development
GO:0010288	response to lead ion
GO:0010719	negative regulation of epithelial to mesenchymal transition
GO:0035331	negative regulation of hippo signaling
GO:0035556	intracellular signal transduction
GO:0035970	peptidyl-threonine dephosphorylation
GO:0040008	regulation of growth
GO:0043029	T cell homeostasis
GO:0045595	regulation of cell differentiation
GO:0051321	meiotic cell cycle
GO:0051898	negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070262	peptidyl-serine dephosphorylation
GO:0071902	positive regulation of protein serine/threonine kinase activity
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly
GO:1904526	regulation of microtubule binding
GO:1904528	positive regulation of microtubule binding
GO:1904539	negative regulation of glycolytic process through fructose-6-phosphate
GO:2000045	regulation of G1/S transition of mitotic cell cycle

	Cellular Component
GO:0000159	protein phosphatase type 2A complex
GO:0000775	chromosome, centromeric region
GO:0000922	spindle pole
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0008287	protein serine/threonine phosphatase complex
GO:0015630	microtubule cytoskeleton
GO:0016020	membrane
GO:0045121	membrane raft
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:0090443	FAR/SIN/STRIPAK complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7cun, PDBe:7cun, PDBj:7cun
PDBsum	7cun
PubMed	33243860
UniProt	P67775\|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (Gene Name=PPP2CA)

[Back to BioLiP]