Structure of PDB 7asn Chain Q

Receptor sequence
>7asnQ (length=112) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKV
LMSALANAEHNYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRT
SHITIVVSDGKE
3D structure
PDB7asn Staphylococcus aureus 50S after 30 minutes incubation a 37C
ChainQ
Resolution2.73 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q V6 A7 R8 R11 R15 K16 R18 R25 K41 A42 S53 A56 N57 H60 N61 N77 E78 P80 R86 P87 R88 A89 Q90 G91 R92 A95 I96 N97 K98 R99 V6 A7 R8 R11 R15 K16 R18 R25 K41 A42 S53 A56 N57 H60 N61 N77 E78 P80 R86 P87 R88 A89 Q90 G91 R92 A95 I96 N97 K98 R99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7asn, PDBe:7asn, PDBj:7asn
PDBsum7asn
PubMed
UniProtQ2FW11|RL22_STAA8 Large ribosomal subunit protein uL22 (Gene Name=rplV)

[Back to BioLiP]