Structure of PDB 7aav Chain Q

Receptor sequence
>7aavQ (length=138) Species: 9606 (Homo sapiens) [Search protein sequence]
KVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRI
HHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCC
LRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCR
3D structure
PDB7aav Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
ChainQ
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q R41 G96 T111 N112 T115 N116 C117 I118 P122 K125 C134 R39 G94 T109 N110 T113 N114 C115 I116 P120 K123 C132
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0030374 nuclear receptor coactivator activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045893 positive regulation of DNA-templated transcription
GO:2000825 positive regulation of androgen receptor activity
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aav, PDBe:7aav, PDBj:7aav
PDBsum7aav
PubMed33243851
UniProtP41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)

[Back to BioLiP]