Structure of PDB 6zmw Chain Q

Receptor sequence

>6zmwQ (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPR

3D structure

PDB

6zmw Structure of a human 48Stranslational initiation complex.

Chain

Resolution

3.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Q	R42 H80 S81	R41 H79 S80
BS02	rna	Q	T2 K3 K4 R5 R6 N7 N8 R10 K13 G14 R15 G16 H17 K32 K34 F39 V75 S76 I79 H80 V83 V84 R85 N86 R87 R89 R92 K93 R95 P98 R100	T1 K2 K3 R4 R5 N6 N7 R9 K12 G13 R14 G15 H16 K31 K33 F38 V74 S75 I78 H79 V82 V83 R84 N85 R86 R88 R91 K92 R94 P97 R99
BS03	ZN	Q	C26 C74 C77	C25 C73 C76

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045296	cadherin binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033119	negative regulation of RNA splicing

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:0098556	cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6zmw, PDBe:6zmw, PDBj:6zmw
PDBsum	6zmw
PubMed	32883864
UniProt	P62854\|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)