Structure of PDB 6ywv Chain Q

Receptor sequence

>6ywvQ (length=353) Species: 367110 (Neurospora crassa OR74A)

MDKLLRRVRMAEGMVARRAQRKNALLKRITERKQNKKNGEAFTEAIQQRK
AAVEARNEDWMLGPLAPRRELDEITLSNGNFFGSLSPTRALLESEVSEEE
RKARVAWCGSPKFLCIAPGDRVVVIEGHHKDLIGTIEKLNTRNMTVEIQS
EKLKTNTTVPQFMQNDADKPVTQIYARLPISSVRLVHPLKDPQTGEYRDV
IIRELRPRNIVHDRPTRTRSMRRFVPGENIIIPWPKQEPIKREDQPADTL
RIDVDEKTFVPTLFRPPAPQQVLDELRNKYSIFRTRHTPEYIAKKEQEEQ
EKEAKKSAAKAMLTPVQEYNRKQRELRRARGQPALTEEMLAKIGEVVARN
KLG

3D structure

• PDB: 6ywv Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
• Chain: Q
• Resolution: 3.03 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	M10 E12 M14 R17 R18 R21 N23 L26 K27 R28 I29 R32 K36 F42 T43 R49 K50 R56 K112 F113 P207 N209 I210 H212 R214 R217 T218 R219 S220 R222 W234 Q237 P239 I240 R242 L276 R277 N278 K279 Y280 S281 I282 F283 R284 H287 T288 Y291 Y319 N320 R321 R324 R327 R328 G331 Q332	M10 E12 M14 R17 R18 R21 N23 L26 K27 R28 I29 R32 K36 F42 T43 R49 K50 R56 K112 F113 P207 N209 I210 H212 R214 R217 T218 R219 S220 R222 W234 Q237 P239 I240 R242 L276 R277 N278 K279 Y280 S281 I282 F283 R284 H287 T288 Y291 Y319 N320 R321 R324 R327 R328 G331 Q332

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005840 ribosome

External links

• PDB: RCSB:6ywv, PDBe:6ywv, PDBj:6ywv
• PDBsum: 6ywv
• PubMed: 33056988
• UniProt: Q7RXU7|RM40_NEUCR Large ribosomal subunit protein uL24m (Gene Name=mrpl40)