Structure of PDB 6wru Chain Q

Receptor sequence
>6wruQ (length=64) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVS
KSDMKRVKQLLAYK
3D structure
PDB6wru Characterization of the Core Ribosomal Binding Region for the Oxazolidone Family of Antibiotics Using Cryo-EM.
ChainQ
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q P2 K3 M4 K5 T6 H7 R8 K12 T17 A18 S19 R24 R26 A27 F28 S30 H31 F33 A34 N35 Q40 R45 S53 R57 Y64 P1 K2 M3 K4 T5 H6 R7 K11 T16 A17 S18 R23 R25 A26 F27 S29 H30 F32 A33 N34 Q39 R44 S52 R56 Y63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wru, PDBe:6wru, PDBj:6wru
PDBsum6wru
PubMed32566908
UniProtQ2FXQ0|RL35_STAA8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]