Structure of PDB 6wde Chain Q

Receptor sequence

>6wdeQ (length=123) Species: 562 (Escherichia coli) [Search protein sequence]

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA

3D structure

PDB

6wde Cryo-EM of elongating ribosome with EF-Tu•GTP elucidates tRNA proofreading.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	N4 Q5 R11 A12 R13 K14 K17 S18 A25 C26 P27 Q28 K29 R30 K42 K43 N45 S46 A47 L48 R49 K50 T57 Y65 G68 E69 R82 G83 R85 V86 K87 D88 P90 R93 R109 K110 Q111 A112 R113 S114 K115 Y116 V118 K119 R120	N4 Q5 R11 A12 R13 K14 K17 S18 A25 C26 P27 Q28 K29 R30 K42 K43 N45 S46 A47 L48 R49 K50 T57 Y65 G68 E69 R82 G83 R85 V86 K87 D88 P90 R93 R109 K110 Q111 A112 R113 S114 K115 Y116 V118 K119 R120

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0034336	misfolded RNA binding

	Biological Process
GO:0000372	Group I intron splicing
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033120	positive regulation of RNA splicing
GO:0034337	RNA folding
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6wde, PDBe:6wde, PDBj:6wde
PDBsum	6wde
PubMed	32612237
UniProt	P0A7S3\|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)