Structure of PDB 6w7m Chain Q

Receptor sequence
>6w7mQ (length=80) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKAV
3D structure
PDB6w7m Alternative conformations and motions adopted by 30S ribosomal subunits visualized by cryo-electron microscopy.
ChainQ
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q E18 I33 K39 R40 T42 H45 R65 P66 L67 S68 K69 T70 K71 W73 E15 I30 K36 R37 T39 H42 R62 P63 L64 S65 K66 T67 K68 W70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w7m, PDBe:6w7m, PDBj:6w7m
PDBsum6w7m
PubMed32989043
UniProtP0AG63|RS17_ECOLI Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]