Structure of PDB 6vyt Chain Q

Receptor sequence

>6vytQ (length=117) Species: 562 (Escherichia coli)

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV

3D structure

• PDB: 6vyt Structural basis of transcription-translation coupling.
• Chain: Q
• Resolution: 14.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	H22 N28 N29 I31 T33 G39 N40 A41 W44 T46 G48 G49 R53 G54 S55 K57 K87 P115 I116 P117 H118 N119 G120 C121 R122 P124 K125 R127 R128	H10 N16 N17 I19 T21 G27 N28 A29 W32 T34 G36 G37 R41 G42 S43 K45 K75 P103 I104 P105 H106 N107 G108 C109 R110 P112 K113 R115 R116

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6vyt, PDBe:6vyt, PDBj:6vyt
• PDBsum: 6vyt
• PubMed: 32820061
• UniProt: P0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)