Structure of PDB 6tmf Chain Q

Receptor sequence

>6tmfQ (length=56) Species: 1293037 (Thermococcus celer Vu 13 = JCM 8558) [Search protein sequence]

MAKADYNKRKPRKFGKGARRCVRCGQYGPVIRVHGLMLCRHCFREIAPKL
GFKKYE

3D structure

PDB

6tmf Molecular analysis of the ribosome recycling factor ABCE1 bound to the 30S post-splitting complex.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	M1 A2 K3 A4 D5 Y6 N7 K8 R9 K10 R12 F14 K16 G17 R19 C24 Q26 P29 I31 R32 H34 R40 H41 R44 E45 K54 Y55 E56	M1 A2 K3 A4 D5 Y6 N7 K8 R9 K10 R12 F14 K16 G17 R19 C24 Q26 P29 I31 R32 H34 R40 H41 R44 E45 K54 Y55 E56
BS02	ZN	Q	C24 C39 C42	C24 C39 C42

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links