Structure of PDB 6tb3 Chain Q

Receptor sequence

>6tb3Q (length=226) Species: 559292 (Saccharomyces cerevisiae S288C)

AVGKNKRLSKGKVVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKSA
SDALKGRVVEVCLADLQGSEDHSFRKIKLRVDEVQGKNLLTNFHGMDFTT
DKLRSMVRKWQTLIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQ
SSHIRAIRKVISEILTKEVQGSTLAQLTSKLIPEVINKEIENATKDIFPL
QNIHVRKVKLLKQPKFDVGALMALHG

3D structure

• PDB: 6tb3 The Ccr4-Not complex monitors the translating ribosome for codon optimality.
• Chain: Q
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	V3 K5 N6 R8 L9 S10 K11 G12 P23 R26 K27 V65 R111 K116 W117 Q118 L120 R136 F138 Q146 N148 Q149 V150 K151 R152 H153 Y155 Q157 S158 S159 R165 K202 D203 I204 P206 K214 K216	V2 K4 N5 R7 L8 S9 K10 G11 P16 R19 K20 V58 R104 K109 W110 Q111 L113 R129 F131 Q139 N141 Q142 V143 K144 R145 H146 Y148 Q150 S151 S152 R158 K195 D196 I197 P199 K207 K209
BS02	rna	Q	K13 G53 L54	K12 G46 L47

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6tb3, PDBe:6tb3, PDBj:6tb3
• PDBsum: 6tb3
• PubMed: 32299921
• UniProt: P33442|RS3A1_YEAST Small ribosomal subunit protein eS1A (Gene Name=RPS1A)