Structure of PDB 6rbd Chain Q

Receptor sequence
>6rbdQ (length=127) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPL
LLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKF
3D structure
PDB6rbd Conformational proofreading of distant 40S ribosomal subunit maturation events by a long-range communication mechanism.
ChainQ
Resolution3.47 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q Q8 T9 F10 K12 K14 H21 G33 E42 R66 R68 G71 G72 G73 H74 V75 S76 Q77 R122 R123 P124 E125 K127 F129 Q6 T7 F8 K10 K12 H19 G31 E40 R64 R66 G69 G70 G71 H72 V73 S74 Q75 R120 R121 P122 E123 K125 F127
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6rbd, PDBe:6rbd, PDBj:6rbd
PDBsum6rbd
PubMed31227701
UniProtP0CX51|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)

[Back to BioLiP]