Structure of PDB 6ppk Chain Q

Receptor sequence

>6ppkQ (length=117) Species: 1423 (Bacillus subtilis)

PRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRR
QKKRDFRKLWITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVN
DLTAFNQLADAAKAQLN

3D structure

• PDB: 6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
• Chain: Q
• Resolution: 4.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	P2 R3 V4 K5 G6 G7 T10 R11 K12 R13 R14 K15 K16 K19 K22 G23 Y24 F25 G26 S27 K28 H29 L31 Y32 K33 N36 Q37 Q38 Y45 F47 R48 D49 R51 K53 K54 R55 F57 R58 K59 T63 N66 R70 S75 Y76 S77 R78 H81 R92 K93 M94	P1 R2 V3 K4 G5 G6 T9 R10 K11 R12 R13 K14 K15 K18 K21 G22 Y23 F24 G25 S26 K27 H28 L30 Y31 K32 N35 Q36 Q37 Y44 F46 R47 D48 R50 K52 K53 R54 F56 R57 K58 T62 N65 R69 S74 Y75 S76 R77 H80 R91 K92 M93

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
• PDBsum: 6ppk
• PubMed: 31665744
• UniProt: P55873|RL20_BACSU Large ribosomal subunit protein bL20 (Gene Name=rplT)