Structure of PDB 6n8o Chain Q

Receptor sequence

>6n8oQ (length=102) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QA

3D structure

PDB

6n8o Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	V2 N3 P5 R8 K9 T10 Y11 K13 K15 R18 K19 H20 Y28 A30 K32 A33 F36 A37 Q38 G39 R41 R42 R45 K46 G49 G52 Q53 T54 K55 P56 V57 F58 K60 A62 K63 K67 R71 R80 Q82 L83 K86 C88 K89 K97 K98	V1 N2 P4 R7 K8 T9 Y10 K12 K14 R17 K18 H19 Y27 A29 K31 A32 F35 A36 Q37 G38 R40 R41 R44 K45 G48 G51 Q52 T53 K54 P55 V56 F57 K59 A61 K62 K66 R70 R79 Q81 L82 K85 C87 K88 K96 K97

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6n8o, PDBe:6n8o, PDBj:6n8o
PDBsum	6n8o
PubMed	30814529
UniProt	P0CX27\|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)