Structure of PDB 6fyy Chain Q

Receptor sequence

>6fyyQ (length=141) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPL
LLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR

3D structure

• PDB: 6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
• Chain: Q
• Resolution: 3.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	Q8 T9 F10 K12 K13 K14 S15 V19 H21 K30 G33 R66 K68 G71 G72 G73 H74 V75 S76 Q77 R114 I118 R122 R123 P124 E125 P126 K127 K128 F129 G130 R132 G133 R135 S136 R137 F138 Q139 K140 S141 Y142 R143	Q6 T7 F8 K10 K11 K12 S13 V17 H19 K28 G31 R64 K66 G69 G70 G71 H72 V73 S74 Q75 R112 I116 R120 R121 P122 E123 P124 K125 K126 F127 G128 R130 G131 R133 S134 R135 F136 Q137 K138 S139 Y140 R141

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
• PDBsum: 6fyy
• PubMed: 30475211
• UniProt: Q875N2|RS16_KLULA Small ribosomal subunit protein uS9 (Gene Name=RPS16)