Structure of PDB 6ff4 Chain Q

Receptor sequence
>6ff4Q (length=138) Species: 9606 (Homo sapiens) [Search protein sequence]
KVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRI
HHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCC
LRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCR
3D structure
PDB6ff4 Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
ChainQ
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q G39 R41 Q95 G96 E98 T111 N112 T115 N116 C117 I118 R120 V121 P122 K125 T135 H136 R140 G37 R39 Q93 G94 E96 T109 N110 T113 N114 C115 I116 R118 V119 P120 K123 T133 H134 R138
BS02 ZN Q C101 C102 C137 C99 C100 C135
BS03 ZN Q C101 R140 C99 R138
BS04 ZN Q C117 C119 C134 C115 C117 C132
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0030374 nuclear receptor coactivator activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045893 positive regulation of DNA-templated transcription
GO:2000825 positive regulation of androgen receptor activity
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ff4, PDBe:6ff4, PDBj:6ff4
PDBsum6ff4
PubMed29361316
UniProtP41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)

[Back to BioLiP]