Structure of PDB 6c23 Chain Q

Receptor sequence

>6c23Q (length=66) Species: 9606 (Homo sapiens) [Search protein sequence]

ADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRK
TFKVDDMLSKVEKMKG

3D structure

PDB

6c23 Structures of human PRC2 with its cofactors AEBP2 and JARID2.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	Q	Q95 R98	Q15 R18

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001222	transcription corepressor binding
GO:0003682	chromatin binding
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0008047	enzyme activator activity
GO:0031490	chromatin DNA binding
GO:0035064	methylated histone binding
GO:0043565	sequence-specific DNA binding
GO:0046872	metal ion binding
GO:0106222	lncRNA binding
GO:1990841	promoter-specific chromatin binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006325	chromatin organization
GO:0008283	cell population proliferation
GO:0008284	positive regulation of cell population proliferation
GO:0045596	negative regulation of cell differentiation
GO:0048709	oligodendrocyte differentiation
GO:0060816	random inactivation of X chromosome
GO:0140718	facultative heterochromatin formation

	Cellular Component
GO:0001739	sex chromatin
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005677	chromatin silencing complex
GO:0005730	nucleolus
GO:0016586	RSC-type complex
GO:0016604	nuclear body
GO:0032993	protein-DNA complex
GO:0035098	ESC/E(Z) complex
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6c23, PDBe:6c23, PDBj:6c23
PDBsum	6c23
PubMed	29348366
UniProt	Q15022\|SUZ12_HUMAN Polycomb protein SUZ12 (Gene Name=SUZ12)