Structure of PDB 5zeb Chain Q

Receptor sequence
>5zebQ (length=113) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
MNTLDFVDQASLRDDIPTFSPGDTVNVHVKVIEGSKERIQVFKGVVIRRQ
GGGISETFTVRKESYGVGVERTFPVHSPNIDHIDVLTRGDVRRAKLYYLR
ELRGKKAKIKEKR
3D structure
PDB5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
ChainQ
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q K36 R38 G104 K105 K106 K108 R113 K36 R38 G104 K105 K106 K108 R113
BS02 rna Q M1 T3 R48 Q50 G51 S55 R92 R93 A94 K95 M1 T3 R48 Q50 G51 S55 R92 R93 A94 K95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
PDBsum5zeb
PubMed30206241
UniProtA0QV42|RL19_MYCS2 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]