Structure of PDB 5t5h Chain Q

Receptor sequence

>5t5hQ (length=203) Species: 5693 (Trypanosoma cruzi) [Search protein sequence]

GAFMYLNELWKKKSSDVMRFIQRVRAWEFRHQHTVVRLRRPTRPEKARML
GYKTKQGFSVFRVRVRRGGRKRPVHKGITYGKPKTSGVLGVKLNKNSRAI
AEQRLGKKYGNLRVLNSYWVNADSTFVWYEVVAVDPMCRTIRRDPRINWI
VNAVHKHREQRGLTSAGRKHRGLRHKGHKASKLRPSVRAAWRRNNRMVFL
RKR

3D structure

PDB

5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.

Chain

Resolution

2.54 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Q	G18 F20 M21 N24 K28 K30 S31 H48 H50 T51 R56 R57 R60 K63 R65 M66 L67 K70 T71 K72 Q73 R83 R84 G85 R87 R89 H92 K93 Y97 K99 P100 K101 T102 G107 V108 K109 L110 N111 K112 N113 S114 R121 K124 G127 N128 N133 W136 M154 R156 T157 R160 R163 W166 A170 V171 K173 H174 Q177 R178 L180 S182 R185 K186 H187 R188 L190 R191 H192 K193 G194 H195 K196 S198 K199 L200 R201 P202 S203 V204 R205 W208 R209 R210 N211 R213 R218 R220	G1 F3 M4 N7 K11 K13 S14 H31 H33 T34 R39 R40 R43 K46 R48 M49 L50 K53 T54 K55 Q56 R66 R67 G68 R70 R72 H75 K76 Y80 K82 P83 K84 T85 G90 V91 K92 L93 N94 K95 N96 S97 R104 K107 G110 N111 N116 W119 M137 R139 T140 R143 R146 W149 A153 V154 K156 H157 Q160 R161 L163 S165 R168 K169 H170 R171 L173 R174 H175 K176 G177 H178 K179 S181 K182 L183 R184 P185 S186 V187 R188 W191 R192 R193 N194 R196 R201 R203
BS02	rna	Q	W44 R47 R83 K88 P90 H92 K93 I95 T96 G98 P100 L106 S141 T142	W27 R30 R66 K71 P73 H75 K76 I78 T79 G81 P83 L89 S124 T125
BS03	rna	Q	R54 Y126 N128 D152	R37 Y109 N111 D135

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5t5h, PDBe:5t5h, PDBj:5t5h
PDBsum	5t5h
PubMed	27791004
UniProt	Q4CTG9

[Back to BioLiP]