Structure of PDB 5oy7 Chain Q

Receptor sequence
>5oy7Q (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB5oy7 Capturing Structural Heterogeneity in Chromatin Fibers.
ChainQ
Resolution5.774 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna Q R42 P43 T45 R63 R72 R83 F84 Q85 S86 R116 V117 T118 R5 P6 T8 R26 R35 R46 F47 Q48 S49 R79 V80 T81
BS02 dna Q H39 R40 Y41 G44 T45 V46 R49 R63 K64 L65 P66 R69 R83 H2 R3 Y4 G7 T8 V9 R12 R26 K27 L28 P29 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5oy7, PDBe:5oy7, PDBj:5oy7
PDBsum5oy7
PubMed28893533
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]