Structure of PDB 5mkn Chain Q |
>5mknQ (length=71) Species: 2187 (Methanococcus vannielii) [Search protein sequence] |
MDTQRPLDALGKSINTNVTVYLKDGKLVKGRLKAYDLHMNVALENAKIES DEEKEFPMLVVRGDNVLYVSL |
|
PDB | 5mkn Crystal structure of SmAP (LSm) protein from Methanococcus vannielii in complex with URIDINE-5'-MONOPHOSPHATE |
Chain | Q |
Resolution | 2.55 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
U5P |
Q |
H39 N41 R63 D65 |
H38 N40 R62 D64 |
|
|
|
|