Structure of PDB 5jvg Chain Q

Receptor sequence
>5jvgQ (length=93) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVI
GISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
3D structure
PDB5jvg Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
ChainQ
Resolution3.428 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q S2 S13 E14 K15 T34 K35 S54 T55 M56 N57 P59 K61 R62 K63 V65 F68 I69 Q71 N73 K76 K77 I79 R81 S1 S12 E13 K14 T33 K34 S53 T54 M55 N56 P58 K60 R61 K62 V64 F67 I68 Q70 N72 K75 K76 I78 R80
BS02 MG Q K35 T55 K76 K34 T54 K75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jvg, PDBe:5jvg, PDBj:5jvg
PDBsum5jvg
PubMed27791159
UniProtQ9RXK0|RL23_DEIRA Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]