Structure of PDB 5jcs Chain Q

Receptor sequence
>5jcsQ (length=185) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKA
LFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTV
AALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVR
HFGMGPHKGKAPRILSTGRKFERARGRRRSKGFKV
3D structure
PDB5jcs Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
ChainQ
Resolution9.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q G2 P43 F44 R66 D89 D90 A91 T107 G134 N136 T137 R141 G142 P143 R144 N145 S146 R147 E148 G154 H158 S181 G183 K185 G1 P42 F43 R65 D88 D89 A90 T106 G133 N135 T136 R140 G141 P142 R143 N144 S145 R146 E147 G153 H157 S180 G182 K184
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jcs, PDBe:5jcs, PDBj:5jcs
PDBsum5jcs
PubMed26619264
UniProtP0CX49|RL18A_YEAST Large ribosomal subunit protein eL18A (Gene Name=RPL18A)

[Back to BioLiP]