Structure of PDB 5h4p Chain Q

Receptor sequence

>5h4pQ (length=185) Species: 559292 (Saccharomyces cerevisiae S288C)

GIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKA
LFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTV
AALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVR
HFGMGPHKGKAPRILSTGRKFERARGRRRSKGFKV

3D structure

• PDB: 5h4p Structural snapshot of cytoplasmic pre-60S ribosomal particles bound by Nmd3, Lsg1, Tif6 and Reh1
• Chain: Q
• Resolution: 3.07 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	G2 S7 K8 Q9 H10 R12 H15 R16 S21 K31 R38 R39 F44 V47 L54 S55 K56 I57 S63 R69 Q73 T86 T88 D89 D90 R92 I93 R105 T107 A108 Q135 N136 T137 I139 R141 R144 N145 S146 R147 E148 R151 F153 A162 R164 S167 R170 K171 F172 R176 R179 R180 S181 K182 G183 F184 K185	G1 S6 K7 Q8 H9 R11 H14 R15 S20 K30 R37 R38 F43 V46 L53 S54 K55 I56 S62 R68 Q72 T85 T87 D88 D89 R91 I92 R104 T106 A107 Q134 N135 T136 I138 R140 R143 N144 S145 R146 E147 R150 F152 A161 R163 S166 R169 K170 F171 R175 R178 R179 S180 K181 G182 F183 K184

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5h4p, PDBe:5h4p, PDBj:5h4p
• PDBsum: 5h4p
• PubMed: 28112732
• UniProt: P0CX49|RL18A_YEAST Large ribosomal subunit protein eL18A (Gene Name=RPL18A)