Structure of PDB 4ndy Chain Q |
>4ndyQ (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] |
SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAK DLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQ KKKKS |
|
PDB | 4ndy The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes. |
Chain | Q |
Resolution | 6.999 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
Q |
T76 K114 |
T63 K101 |
|
|
|
|