Structure of PDB 4ki7 Chain Q |
>4ki7Q (length=137) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] |
LIVNVINGPNLGRLGRRYGGTTHDELVALIEREAAELGLKAVVRQSDSEA QLLDWIHQAADAAEPVILNAGGLTHTSVALRDACAELSAPLIEVHISNVH AREEFRRHSYLSPIATGVIVGLGIQGYLLALRYLAEH |
|
PDB | 4ki7 Design and Structural Analysis of Aromatic Inhibitors of Type II Dehydroquinase from Mycobacterium tuberculosis. |
Chain | Q |
Resolution | 2.8 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1R2 |
Q |
D88 E92 |
D82 E86 |
|
|
|
|