Structure of PDB 4ioa Chain Q

Receptor sequence
>4ioaQ (length=93) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVI
GISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
3D structure
PDB4ioa Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
ChainQ
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Q S13 E14 K15 K32 T34 K35 K39 R49 S54 T55 M56 N57 K61 R62 R64 F68 G70 Q71 R72 N73 K76 K77 I79 R81 S12 E13 K14 K31 T33 K34 K38 R48 S53 T54 M55 N56 K60 R61 R63 F67 G69 Q70 R71 N72 K75 K76 I78 R80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4ioa, PDBe:4ioa, PDBj:4ioa
PDBsum4ioa
PubMed23414806
UniProtQ9RXK0|RL23_DEIRA Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]