Structure of PDB 4io9 Chain Q

Receptor sequence
>4io9Q (length=93) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVI
GISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
3D structure
PDB4io9 Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
ChainQ
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q S13 E14 K15 T34 K35 T36 K39 S54 T55 M56 N57 V58 K63 R64 F68 G70 Q71 R72 N73 K76 K77 I79 R81 S12 E13 K14 T33 K34 T35 K38 S53 T54 M55 N56 V57 K62 R63 F67 G69 Q70 R71 N72 K75 K76 I78 R80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4io9, PDBe:4io9, PDBj:4io9
PDBsum4io9
PubMed23414806
UniProtQ9RXK0|RL23_DEIRA Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]