Structure of PDB 4b3m Chain Q

Receptor sequence

>4b3mQ (length=104) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
GGKA

3D structure

PDB

4b3m 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	P1 K2 S11 K13 M14 Q15 K16 T17 R24 L30 Y31 K33 R37 S38 K39 K40 Y41 E60 S61 R62 P63 I64 S65 K66 R67 K68 R69 R71 K86 N93 Y94 L97 S98 K99 G102 K103 A104	P1 K2 S11 K13 M14 Q15 K16 T17 R24 L30 Y31 K33 R37 S38 K39 K40 Y41 E60 S61 R62 P63 I64 S65 K66 R67 K68 R69 R71 K86 N93 Y94 L97 S98 K99 G102 K103 A104
BS02	MG	Q	D12 M14 E48	D12 M14 E48

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4b3m, PDBe:4b3m, PDBj:4b3m
PDBsum	4b3m
PubMed	24473108
UniProt	P0DOY7\|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)