Structure of PDB 4aqy Chain Q

Receptor sequence

>4aqyQ (length=104) Species: 274 (Thermus thermophilus) [Search protein sequence]

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
GGKA

3D structure

PDB

4aqy Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	P2 K3 S12 K14 M15 Q16 K17 T18 R25 P28 L31 Y32 K34 K37 R38 S39 K40 K41 Y42 E61 S62 R63 P64 I65 S66 K67 R68 K69 R70 R72 R91 R92 N94 Y95 L98 S99 K100 G103 K104 A105	P1 K2 S11 K13 M14 Q15 K16 T17 R24 P27 L30 Y31 K33 K36 R37 S38 K39 K40 Y41 E60 S61 R62 P63 I64 S65 K66 R67 K68 R69 R71 R90 R91 N93 Y94 L97 S98 K99 G102 K103 A104

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4aqy, PDBe:4aqy, PDBj:4aqy
PDBsum	4aqy
PubMed	22699498
UniProt	P0DOY7\|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)