Structure of PDB 3pvo Chain Q

Receptor sequence
>3pvoQ (length=206) Species: 9606 (Homo sapiens) [Search protein sequence]
QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYS
IFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSW
ESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQ
SLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFT
KPQLWP
3D structure
PDB3pvo A Staggered Decameric Assembly of Human C-Reactive Protein Stabilized by Zinc Ions Revealed by X-ray Crystallography.
ChainQ
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA Q D60 N61 E138 Q139 D140 D60 N61 E138 Q139 D140
BS02 CA Q E138 D140 E147 Q150 E138 D140 E147 Q150
Gene Ontology
Molecular Function
GO:0001849 complement component C1q complex binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0030169 low-density lipoprotein particle binding
GO:0033265 choline binding
GO:0042802 identical protein binding
GO:0046790 virion binding
GO:0046872 metal ion binding
GO:0050750 low-density lipoprotein particle receptor binding
Biological Process
GO:0006953 acute-phase response
GO:0006954 inflammatory response
GO:0008228 opsonization
GO:0010628 positive regulation of gene expression
GO:0010745 negative regulation of macrophage derived foam cell differentiation
GO:0010888 negative regulation of lipid storage
GO:0032677 regulation of interleukin-8 production
GO:0032930 positive regulation of superoxide anion generation
GO:0032945 negative regulation of mononuclear cell proliferation
GO:0042310 vasoconstriction
GO:0045087 innate immune response
GO:0050830 defense response to Gram-positive bacterium
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3pvo, PDBe:3pvo, PDBj:3pvo
PDBsum3pvo
PubMed25552313
UniProtP02741|CRP_HUMAN C-reactive protein (Gene Name=CRP)

[Back to BioLiP]