Structure of PDB 3jd5 Chain Q

Receptor sequence
>3jd5Q (length=109) Species: 9913 (Bos taurus) [Search protein sequence]
MSVVRSSVHAKWIVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYF
AHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIVFKVGQVVDPVTGKRC
AGTTYLESP
3D structure
PDB3jd5 Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
ChainQ
Resolution7.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q R5 S6 S7 V8 H9 A21 M22 Q23 K24 T25 K27 R32 N44 R46 K47 T48 Y49 F50 H52 R73 T74 H76 R5 S6 S7 V8 H9 A21 M22 Q23 K24 T25 K27 R32 N44 R46 K47 T48 Y49 F50 H52 R73 T74 H76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jd5, PDBe:3jd5, PDBj:3jd5
PDBsum3jd5
PubMed24799711
UniProtP82916|RT17_BOVIN Small ribosomal subunit protein uS17m (Gene Name=MRPS17)

[Back to BioLiP]