Structure of PDB 3jam Chain Q

Receptor sequence

>3jamQ (length=141) Species: 28985 (Kluyveromyces lactis)

TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPL
LLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR

3D structure

• PDB: 3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
• Chain: Q
• Resolution: 3.46 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	Q8 T9 F10 K14 S15 V19 H21 K26 L28 K30 E42 R66 K68 T70 G71 G72 G73 H74 S76 Q77 I118 S121 R122 R123 P124 E125 P126 K127 K128 F129 R132 G133 A134 R135 S136 R137 F138 Q139 K140 S141 Y142 R143	Q6 T7 F8 K12 S13 V17 H19 K24 L26 K28 E40 R64 K66 T68 G69 G70 G71 H72 S74 Q75 I116 S119 R120 R121 P122 E123 P124 K125 K126 F127 R130 G131 A132 R133 S134 R135 F136 Q137 K138 S139 Y140 R141

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jam, PDBe:3jam, PDBj:3jam
• PDBsum: 3jam
• PubMed: 26212456
• UniProt: Q875N2|RS16_KLULA Small ribosomal subunit protein uS9 (Gene Name=RPS16)