Structure of PDB 3j81 Chain Q

Receptor sequence

>3j81Q (length=141) Species: 28985 (Kluyveromyces lactis)

TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPL
LLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR

3D structure

• PDB: 3j81 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
• Chain: Q
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	Q8 T9 F10 K12 K14 S15 K23 K26 Q40 R66 T70 G71 G72 G73 H74 V75 S76 I118 R122 R123 P124 E125 P126 K127 K128 F129 R132 G133 A134 R135 S136 R137 F138 Q139 K140 S141 Y142	Q6 T7 F8 K10 K12 S13 K21 K24 Q38 R64 T68 G69 G70 G71 H72 V73 S74 I116 R120 R121 P122 E123 P124 K125 K126 F127 R130 G131 A132 R133 S134 R135 F136 Q137 K138 S139 Y140

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j81, PDBe:3j81, PDBj:3j81
• PDBsum: 3j81
• PubMed: 25417110
• UniProt: Q875N2|RS16_KLULA Small ribosomal subunit protein uS9 (Gene Name=RPS16)