Structure of PDB 3j79 Chain Q

Receptor sequence

>3j79Q (length=189) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

GRRPARCYRYCKNKPYPKSRYCRGVPDPKIRIYDMGRKKADVNEFSGVVH
LVSYEYEQISSEALEAARISANKYMITNCGKDNFHLRVRIHPFHVLRINK
AFGKPNGVVARVDIGQVLLSIRTKENFVSKACEALRRAKYKFPGRQKVFV
SNKWGFTPFSKDEYQQYKKKGRIISDGVSCKFIREKGPL

3D structure

PDB

3j79 Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	R3 R4 P5 A6 R7 C8 K13 N14 K15 P16 Y17 Y22 R24 K30 Y34 D35 K39 S61 E63 A64 A67 R88 R90 H92 F94 R98 F119 G120 Q133 R154 Y157 K158 P160 G194 K198	R2 R3 P4 A5 R6 C7 K12 N13 K14 P15 Y16 Y21 R23 K29 Y33 D34 K38 S60 E62 A63 A66 R87 R89 H91 F93 R97 F102 G103 Q116 R137 Y140 K141 P143 G177 K181
BS02	rna	Q	Y11 E56 Y57 R201 E202 K203 G204 P205 L206	Y10 E55 Y56 R184 E185 K186 G187 P188 L189

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j79, PDBe:3j79, PDBj:3j79
PDBsum	3j79
PubMed	24913268
UniProt	Q8ILV2

[Back to BioLiP]