Structure of PDB 3az8 Chain Q |
>3az8Q (length=142) Species: 5833 (Plasmodium falciparum) [Search protein sequence] |
DTSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGLKQVSTNEPFFNGH FPQKQIMPGVLQIEALAQLAGILCLKSDDSQKNNLFLFAGVDGVRWKKPV LPGDTLTMQANLISFKGIAKLSGVGYVNGKVVINISEMTFAL |
|
PDB | 3az8 Structural basis for the functional and inhibitory mechanisms of beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) of Plasmodium falciparum |
Chain | Q |
Resolution | 3.1 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
S21 |
Q |
H133 M140 P141 G142 |
H50 M57 P58 G59 |
|
|
|
|