Structure of PDB 1tqe Chain Q

Receptor sequence
>1tqeQ (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]
GRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSA
NRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRR
3D structure
PDB1tqe Mechanism of Recruitment of Class II Histone Deacetylases by Myocyte Enhancer Factor-2.
ChainQ
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna Q G2 R3 Q18 K31 G1 R2 Q17 K30 PDBbind-CN: Kd=0.72uM
BS02 dna Q G2 R3 K4 I6 K23 R24 K30 G1 R2 K3 I5 K22 R23 K29 PDBbind-CN: Kd=0.72uM
BS03 peptide Q D63 L66 L67 Y69 T70 H76 D83 D62 L65 L66 Y68 T69 H75 D82
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1tqe, PDBe:1tqe, PDBj:1tqe
PDBsum1tqe
PubMed15567413
UniProtQ02080|MEF2B_HUMAN Myocyte-specific enhancer factor 2B (Gene Name=MEF2B)

[Back to BioLiP]