Structure of PDB 1q86 Chain Q

Receptor sequence

>1q86Q (length=143) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQ
AKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRA
QRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA

3D structure

PDB

1q86 Structural insights into peptide bond formation.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	T1 D2 L3 K7 R8 G17 K18 N19 R20 W22 F23 P25 Q28 T36 R37 R41 K52 K54 K55 G56 N57 S58 R59 R61 R63 R65 Q66 K68 R69 A70 K71 H73 Q74 K75 G76 G78 R80 K81 G82 K83 A84 G85 A86 R87 Q88 K91 W94 E95 S96 R99 A100 R102 R109 S116 S117 Y119 R120 Y123 D124 G127 G128 E130 S133 V134	T1 D2 L3 K7 R8 G17 K18 N19 R20 W22 F23 P25 Q28 T36 R37 R41 K52 K54 K55 G56 N57 S58 R59 R61 R63 R65 Q66 K68 R69 A70 K71 H73 Q74 K75 G76 G78 R80 K81 G82 K83 A84 G85 A86 R87 Q88 K91 W94 E95 S96 R99 A100 R102 R109 S116 S117 Y119 R120 Y123 D124 G127 G128 E130 S133 V134

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1q86, PDBe:1q86, PDBj:1q86
PDBsum	1q86
PubMed	12185246
UniProt	P14119\|RL19E_HALMA Large ribosomal subunit protein eL19 (Gene Name=rpl19e)

[Back to BioLiP]